Anti-BAF53b Antibody FL550 Conjugate, IgG1, Clone: [N332B/15], Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-BAF53b Antibody FL550 Conjugate, IgG1, Clone: [N332B/15], Mouse, Monoclonal
• Artikelnummer: ANI-75-311-FL550
• Hersteller Artikelnummer: 75-311-FL550
• Alternativnummer: ANI-75-311-FL550
• Hersteller: Antibodies Incorporated
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ICC, IHC
• Spezies Reaktivität: Human, Mouse
• Immunogen: Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli
• Konjugation: FL550
• Alternative Synonym: Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)

Produktbeschreibung

Our Anti-BAF53b mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by Protein A chromatography. It is great for use in IHC, ICC.

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 0.5 mg/mL
• Klon-Bezeichnung: [N332B/15]
• Molekulargewicht: 53 kDa
• Isotyp: IgG1
• UniProt: O94805
• Puffer: PBS with 0.09% azide
• Reinheit: Purified by Protein A chromatography
• Formulierung: Purified by Protein A chromatography
• Target-Kategorie: BAF53b
• Antibody Type: Primary Antibody