Anti-Kv1.2 Potassium Channel Subunit Antibody (BSA and Azide free), IgG2a, Clone: [L76/36], Unconjugated, Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-Kv1.2 Potassium Channel Subunit Antibody (BSA and Azide free), IgG2a, Clone: [L76/36], Unconjugated, Mouse, Monoclonal
• Artikelnummer: ANI-75-314-CF
• Hersteller Artikelnummer: 75-314-CF
• Alternativnummer: ANI-75-314-CF
• Hersteller: Antibodies Incorporated
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ELISA, ICC, IHC, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (accession number P16389) produced recombinantly in E. Coli
• Konjugation: Unconjugated
• Alternative Synonym: Potassium voltage-gated channel subfamily A member 2 (NGK1) (Voltage-gated K(+) channel HuKIV) (Voltage-gated potassium channel HBK5) (Voltage-gated potassium channel subunit Kv1.2)

Produktbeschreibung

Our carrier-free Anti-Kv1.2 potassium channel subunit mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone L76/36. It is KO validated, detects human, mouse, and rat Kv1.2 potassium channel subunit, and is purified by Protein A chromatography. It is great for use in IHC, WB.

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 1 mg/mL
• Klon-Bezeichnung: [L76/36]
• Molekulargewicht: 80 kDa
• Isotyp: IgG2a
• UniProt: P16389
• Puffer: PBS
• Target-Kategorie: Kv1.2 potassium channel subunit
• Antibody Type: Primary Antibody