Anti-GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb (BSA and Azide free), Clone: [L21/32], Unconjugated, Gallus

Artikelnummer: ANI-78-002-CF
Artikelname: Anti-GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb (BSA and Azide free), Clone: [L21/32], Unconjugated, Gallus
Artikelnummer: ANI-78-002-CF
Hersteller Artikelnummer: 78-002-CF
Alternativnummer: ANI-78-002-CF
Hersteller: Antibodies Incorporated
Wirt: Gallus
Kategorie: Antikörper
Applikation: ELISA, EM, ICC, IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
Konjugation: Unconjugated
Alternative Synonym: Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
Our chicken Anti-GluA2/GluR2 glutamate receptor carrier-free recombinant monoclonal antibody is a chimeric antibody derived from NeuroMab clone L21/32. It detects human, mouse, and rat GluA2/GluR2 is purified by affinity chromatography. It works in WB, IHC, ICC, ELISA.
Klonalität: Recombinant
Konzentration: 1 mg/mL
Klon-Bezeichnung: [L21/32]
Molekulargewicht: 90 kDa
UniProt: P19491
Puffer: 1
Target-Kategorie: GluA2/GluR2 glutamate receptor
Antibody Type: Primary Antibody
Application Verdünnung: Dilution Range: WB: 1:500-1:1000. Dilution Range: IHC: 1:250-1:500. Dilution Range: ICC: 1:500
Anwendungsbeschreibung: Format: Purified by affinity chromatography