TBC1D8B Peptide - N-terminal region

Artikelnummer: BYT-ORB2004247

Bilder (0)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	TBC1D8B Peptide - N-terminal region
Artikelnummer:	BYT-ORB2004247
Hersteller Artikelnummer:	orb2004247
Alternativnummer:	BYT-ORB2004247-100
Hersteller:	Biorbyt
Kategorie:	Proteine/Peptide
Applikation:	WB

NCBI:	942582
UniProt:	Q0IIM8
Puffer:	Lyophilized powder
Formulierung:	Lyophilized powder
Sequenz:	Synthetic peptide located within the following region: FDSNEDITNFVQGKIRGLIAEEGKHCFAKEDDPEKFREALLKFEKCFGLP

Anwendungsbeschreibung:

Application Notes: This is a synthetic peptide designed for use in combination with TBC1D8B Rabbit Polyclonal Antibody (orb587763). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten