TBC1D8B Peptide - N-terminal region

Product Overview

• Article Name: TBC1D8B Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004247
• Supplier Catalog Number: orb2004247
• Alternative Catalog Number: BYT-ORB2004247-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

TBC1D8B Peptide - N-terminal region

Product Properties

• NCBI: 942582
• UniProt: Q0IIM8
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: FDSNEDITNFVQGKIRGLIAEEGKHCFAKEDDPEKFREALLKFEKCFGLP

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TBC1D8B Rabbit Polyclonal Antibody (orb587763). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings