SUGP2 Antibody : Biotin (ARP40305_P050-Biotin), Rabbit, Polyclonal

Produktübersicht

• Artikelname: SUGP2 Antibody : Biotin (ARP40305_P050-Biotin), Rabbit, Polyclonal
• Artikelnummer: ASB-ARP40305_P050-BIOTIN
• Hersteller Artikelnummer: ARP40305_P050-Biotin
• Alternativnummer: ASB-ARP40305_P050-BIOTIN-100UL
• Hersteller: Aviva
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence PGPSFRSSNPSISDDSYFRKECGRDLEFSHSDSRDQVIGHRKLGHFRSQD
• Konjugation: Biotin
• Alternative Synonym: SFRS14, SRFS14

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 120 kDa
• NCBI: 10147
• UniProt: Q8IX01
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.