HERC3 Antibody : Biotin (ARP43160_P050-Biotin), Rabbit, Polyclonal
Artikelnummer:
ASB-ARP43160_P050-BIOTIN
- Bilder (0)
| Artikelname: | HERC3 Antibody : Biotin (ARP43160_P050-Biotin), Rabbit, Polyclonal |
| Artikelnummer: | ASB-ARP43160_P050-BIOTIN |
| Hersteller Artikelnummer: | ARP43160_P050-Biotin |
| Alternativnummer: | ASB-ARP43160_P050-BIOTIN-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Spezies Reaktivität: | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence IPLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLL |
| Konjugation: | Biotin |
