DZIP3 Antibody : Biotin (ARP43162_P050-Biotin), Rabbit, Polyclonal

Produktübersicht

• Artikelname: DZIP3 Antibody : Biotin (ARP43162_P050-Biotin), Rabbit, Polyclonal
• Artikelnummer: ASB-ARP43162_P050-BIOTIN
• Hersteller Artikelnummer: ARP43162_P050-Biotin
• Alternativnummer: ASB-ARP43162_P050-BIOTIN-100UL
• Hersteller: Aviva
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence NLSVLPCAHKFHAQCIRPWLMQQGTCPTCRLHVLLPEEFPGHPSRQLPKI
• Konjugation: Biotin
• Alternative Synonym: UURF2, PPP1R66, hRUL138

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 139 kDa
• NCBI: 9666
• UniProt: Q86Y13
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.