NOX3 Antibody : HRP (ARP47185_P050-HRP), Rabbit, Polyclonal

Produktübersicht

• Artikelname: NOX3 Antibody : HRP (ARP47185_P050-HRP), Rabbit, Polyclonal
• Artikelnummer: ASB-ARP47185_P050-HRP
• Hersteller Artikelnummer: ARP47185_P050-HRP
• Alternativnummer: ASB-ARP47185_P050-HRP-100UL
• Hersteller: Aviva
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC
• Spezies Reaktivität: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF
• Konjugation: HRP
• Alternative Synonym: MOX-2, GP91-3

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 65 kDa
• NCBI: 50508
• UniProt: Q9HBY0
• Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.