MBTPS2 Antibody : FITC (ARP47191_P050-FITC), Rabbit, Polyclonal
Artikelnummer:
ASB-ARP47191_P050-FITC
- Bilder (0)
| Artikelname: | MBTPS2 Antibody : FITC (ARP47191_P050-FITC), Rabbit, Polyclonal |
| Artikelnummer: | ASB-ARP47191_P050-FITC |
| Hersteller Artikelnummer: | ARP47191_P050-FITC |
| Alternativnummer: | ASB-ARP47191_P050-FITC-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Spezies Reaktivität: | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence LVVVVVGGWTVVYLTDLVLKSSVYFKHSYEDWLENNGLSISPFHIRWQTA |
| Konjugation: | FITC |
| Alternative Synonym: | S2P, IFAP, KFSD, OI19, KFSDX, OLMSX, BRESEK |
