CHCHD4 Antibody : HRP (ARP51896_P050-HRP), Rabbit, Polyclonal

Produktübersicht

• Artikelname: CHCHD4 Antibody : HRP (ARP51896_P050-HRP), Rabbit, Polyclonal
• Artikelnummer: ASB-ARP51896_P050-HRP
• Hersteller Artikelnummer: ARP51896_P050-HRP
• Alternativnummer: ASB-ARP51896_P050-HRP-100UL
• Hersteller: Aviva
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Canine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence HYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAE
• Konjugation: HRP
• Alternative Synonym: MIA40, TIMM40

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 16 kDa
• NCBI: 131474
• UniProt: Q8N4Q1
• Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.