Recombinant Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) IgG receptor FcRn large subunit p51

Artikelnummer: ASB-OPCA01437
Artikelname: Recombinant Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) IgG receptor FcRn large subunit p51
Artikelnummer: ASB-OPCA01437
Hersteller Artikelnummer: OPCA01437
Alternativnummer: ASB-OPCA01437-100UG,ASB-OPCA01437-1MG,ASB-OPCA01437-20UG
Hersteller: Aviva
Kategorie: Antikörper
Applikation: ELISA, SDS-PAGE, WB
Spezies Reaktivität: Bacteria, Primate
Alternative Synonym: Fc fragment of IgG, receptor, transporter, alpha,Fcrn,IgG Fc fragment receptor transporter alpha chain,IgG receptor FcRn large subunit p51,Neonatal Fc receptor.
Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the selective uptake of IgG from milk and helps newborn animals to acquire passive immunity. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids (By similarity). Possible role in transfer of immunoglobulin G from mother to fetus (By similarity).
Molekulargewicht: 46.4 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 102128913
UniProt: Q8SPV9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQ