FLAD1 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02434
Artikelname: FLAD1 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02434
Hersteller Artikelnummer: OPCA02434
Alternativnummer: ASB-OPCA02434-100UG,ASB-OPCA02434-1MG,ASB-OPCA02434-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: FAD pyrophosphorylase,FAD synthase,FAD1,Fad1, flavin adenine dinucleotide synthetase, homolog,FADS,FAD-synthetase,Flavin adenine dinucleotide synthase,FMN adenylyltransferase,LSMFLAD,PP591.
Catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.
Molekulargewicht: 58.3 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 80308
UniProt: Q8NFF5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MTSRASELSPGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATKALGGEGWEKLSLVPSSARLHYGTDPCTGQPFRFPLVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEAQAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLV