Bglap Recombinant Protein, Mouse

Produktübersicht

• Artikelname: Bglap Recombinant Protein, Mouse
• Artikelnummer: ASB-OPCA03205
• Hersteller Artikelnummer: OPCA03205
• Alternativnummer: ASB-OPCA03205-20UG,ASB-OPCA03205-100UG,ASB-OPCA03205-1MG
• Hersteller: Aviva
• Wirt: Mouse
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Alternative Synonym: Bgl,Bglap1,BGP,bone gamma carboxyglutamate protein 1,bone Gla protein,gamma-carboxyglutamic acid-containing protein,mOC,mOC-A,O,OC,OG,OG1,oste,osteocalcin.

Produktbeschreibung

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Produkteigenschaften

• Molekulargewicht: 21.1 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• NCBI: 12096
• UniProt: P86546
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI