RNF125 Recombinant Protein (Human)

Produktübersicht

• Artikelname: RNF125 Recombinant Protein (Human)
• Artikelnummer: ASB-OPCA04791
• Hersteller Artikelnummer: OPCA04791
• Alternativnummer: ASB-OPCA04791-100UG, ASB-OPCA04791-1MG, ASB-OPCA04791-20UG
• Hersteller: Aviva
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: E3 ubiquitin-protein ligase RNF125,RING finger protein 125,ring finger protein 125, E3 ubiquitin protein ligase,T-cell RING activation protein 1,T-cell ring protein identified in activation screen,TNORS,TRAC1,TRAC-1.

Produktbeschreibung

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins, such as DDX58/RIG-I, MAVS/IPS1, IFIH1/MDA5, JAK1 and p53/TP53 (PubMed:15843525, PubMed:17460044, PubMed:17643463, PubMed:26027934, PubMed:26471729, PubMed:25591766, PubMed:27411375). Acts as a negative regulator of type I interferon production by mediating ubiquitination of DDX58/RIG-I at Lys-181, leading to DDX58/RIG-I degradation (PubMed:17460044, PubMed:26471729). Mediates ubiquitination and subsequent degradation of p53/TP53 (PubMed:25591766). Mediates ubiquitination and subsequent degradation of JAK1 (PubMed:26027934). Acts as a positive regulator of T-cell activation (PubMed:15843525).

Produkteigenschaften

• Molekulargewicht: 53.3 kDa
• Tag: N-terminal GST-tagged
• NCBI: 54941
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT