TIAF1 Recombinant Protein (Human)

Artikelnummer: ASB-OPCA04803
Artikelname: TIAF1 Recombinant Protein (Human)
Artikelnummer: ASB-OPCA04803
Hersteller Artikelnummer: OPCA04803
Alternativnummer: ASB-OPCA04803-100UG, ASB-OPCA04803-1MG, ASB-OPCA04803-20UG
Hersteller: Aviva
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: 12 kDa TGF-beta-1-induced antiapoptotic factor,MAJN,molecule associated with Jak-3 N-terminal,SPR210,TGFB1-induced anti-apoptotic factor 1,TGF-beta-1-induced antiapoptotic factor 1.
Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.
Molekulargewicht: 39.4 kDa
Tag: N-terminal GST-tagged
NCBI: 9220
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG