YWHAQ Recombinant Protein (Human)

Artikelnummer: ASB-OPCA04806
Artikelname: YWHAQ Recombinant Protein (Human)
Artikelnummer: ASB-OPCA04806
Hersteller Artikelnummer: OPCA04806
Alternativnummer: ASB-OPCA04806-100UG, ASB-OPCA04806-1MG, ASB-OPCA04806-20UG
Hersteller: Aviva
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: 14-3-3,14-3-3 protein tau,14-3-3 protein T-cell,14-3-3 protein theta,14-3-3 theta,1C5,HS1,Protein HS1,protein, theta,tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide.
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
Molekulargewicht: 54.8 kDa
Tag: N-terminal GST-tagged
NCBI: 10971
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN