ACE2 Recombinant Protein

Artikelnummer: ASB-OPCA335977
Artikelname: ACE2 Recombinant Protein
Artikelnummer: ASB-OPCA335977
Hersteller Artikelnummer: OPCA335977
Alternativnummer: ASB-OPCA335977-10UG, ASB-OPCA335977-1MG, ASB-OPCA335977-500UG, ASB-OPCA335977-50UG
Hersteller: Aviva
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Alternative Synonym: ACEH,ACE-related carboxypeptidase,angiotensin I converting enzyme (peptidyl-dipeptidase A) 2,angiotensin I converting enzyme 2,angiotensin-converting enzyme 2,angiotensin-converting enzyme homolog,angiotensin-converting enzyme-related carboxypeptidase,metalloprotease MPROT15,peptidyl-dipeptidase A,truncated angiotensin converting enzyme 2.
Essential counter-regulatory carboxypeptidase of the renin-angiotensin hormone system that is a critical regulator of blood volume, systemic vascular resistance, and thus cardiovascular homeostasis (PubMed:27217402). Converts angiotensin I to angiotensin 1-9, a nine-amino acid peptide with anti-hypertrophic effects in cardiomyocytes, and angiotensin II to angiotensin 1-7, which then acts as a beneficial vasodilator and anti-proliferation agent, counterbalancing the actions of the vasoconstrictor angiotensin II (PubMed:10969042, PubMed:10924499, PubMed:11815627, PubMed:19021774, PubMed:14504186). Also removes the C-terminal residue from three other vasoactive peptides, neurotensin, kinetensin, and des-Arg bradykinin, but is not active on bradykinin (PubMed:10969042, PubMed:11815627). Also cleaves other biological peptides, such as apelins (apelin-13, [Pyr1]apelin-13, apelin-17, apelin-36), casomorphins (beta-casomorphin-7, neocasomorphin) and dynorphin A with high efficiency (PubMed:11815627, PubMed:27217402, PubMed:28293165). In addition, ACE2 C-terminus is homologous to collectrin and is responsible for the trafficking of the neutral amino acid transporter SL6A19 to the plasma membrane of gut epithelial cells via direct interaction, regulating its expression on the cell surface and its catalytic activity (PubMed:18424768, PubMed:19185582).
Molekulargewicht: 84.63 kDa
Tag: C-terminal 6xHis-tagged
NCBI: 59272
Puffer: 0.2 um Filtered 20 mM Tris, 300 mM NaCl, 1 mM ZnCl2, 10% Glycerol, pH 7.4
Quelle: Mammalian Cells
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid
Sequenz: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG