Recombinant Streptavidin Protein

Artikelnummer: ASB-OPPA02060
Artikelname: Recombinant Streptavidin Protein
Artikelnummer: ASB-OPPA02060
Hersteller Artikelnummer: OPPA02060
Alternativnummer: ASB-OPPA02060-20MG, ASB-OPPA02060-5MG
Hersteller: Aviva
Kategorie: Proteine/Peptide
Alternative Synonym: Streptavidin, Streptavidin Recombinant
Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14). The complexes are also extremely stable over a wide range of temperature and pH.
Konzentration: 0.5 mg/ml (prior to lyophilization)
Molekulargewicht: 52 kDa
Quelle: E. coli
Reinheit: Greater than 98.0% as determined by SDS-PAGE and RP-HPLC.
Formulierung: Lyophilizedin 10mM potassium phosphate buffer pH 6.5Physical Appearance: Sterile filtered white powder.
Sequenz: MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.