Anti-CD45

Artikelnummer: ATA-AMAB90519
Artikelname: Anti-CD45
Artikelnummer: ATA-AMAB90519
Hersteller Artikelnummer: AMAb90519
Alternativnummer: ATA-AMAB90519-100,ATA-AMAB90519-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PTPRC, GP180, LCA, T200
protein tyrosine phosphatase, receptor type C
Anti-CD45
Klonalität: Monoclonal
Konzentration: 0.8
Klon-Bezeichnung: [CL0160]
Isotyp: IgG2a
NCBI: 5788
UniProt: P08575
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PTPRC
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 1 µg/ml
Immunohistochemical staining of human tonsil shows strong positivity in a majority of lymphoid cells
Immunohistochemical staining of human appendix shows strong positivity in lymphoid cells but no positivity in glandular cells.
Lane 1: Marker [kDa]
Lane 2: Human cell line Jurkat
Lane 3: Human cell line MCF-7
AMAb90519-100ul
AMAb90519-100ul
AMAb90519-100ul