Anti-CD45
Artikelnummer:
ATA-AMAB90519
- Bilder (7)
| Artikelname: | Anti-CD45 |
| Artikelnummer: | ATA-AMAB90519 |
| Hersteller Artikelnummer: | AMAb90519 |
| Alternativnummer: | ATA-AMAB90519-100,ATA-AMAB90519-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PTPRC, GP180, LCA, T200 |
| protein tyrosine phosphatase, receptor type C |
| Anti-CD45 |
| Klonalität: | Monoclonal |
| Konzentration: | 0.8 |
| Klon-Bezeichnung: | [CL0160] |
| Isotyp: | IgG2a |
| NCBI: | 5788 |
| UniProt: | P08575 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PTPRC |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human tonsil shows strong positivity in a majority of lymphoid cells |
|
|
Immunohistochemical staining of human appendix shows strong positivity in lymphoid cells but no positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line Jurkat Lane 3: Human cell line MCF-7 |
|
|
AMAb90519-100ul |
|
|
|
|
|
AMAb90519-100ul |
|
|
AMAb90519-100ul |
Produktgarantie und fachkundiger Support
