Anti-ARG1
Artikelnummer:
ATA-AMAB90545
- Bilder (7)
| Artikelname: | Anti-ARG1 |
| Artikelnummer: | ATA-AMAB90545 |
| Hersteller Artikelnummer: | AMAb90545 |
| Alternativnummer: | ATA-AMAB90545-100,ATA-AMAB90545-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ARG1 |
| arginase, liver |
| Anti-ARG1 |
| Klonalität: | Monoclonal |
| Konzentration: | 0.4 |
| Klon-Bezeichnung: | [CL0186] |
| Isotyp: | IgG1 |
| NCBI: | 383 |
| UniProt: | P05089 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | TIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ARG1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human liver shows strong nuclear and cytoplasmatic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human prostate shows no immunoreactivity (negative control). |
|
|
Lane 1: Marker [kDa] Lane 2: Human liver tissue lysate |
|
|
AMAb90545-100ul |
|
|
|
|
|
AMAb90545-100ul |
|
|
AMAb90545-100ul |
Produktgarantie und fachkundiger Support
