Anti-FABP7
Artikelnummer:
ATA-AMAB90595
- Bilder (7)
| Artikelname: | Anti-FABP7 |
| Artikelnummer: | ATA-AMAB90595 |
| Hersteller Artikelnummer: | AMAb90595 |
| Alternativnummer: | ATA-AMAB90595-100,ATA-AMAB90595-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | B-FABP, BLBP |
| fatty acid binding protein 7, brain |
| Anti-FABP7 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL0236] |
| Isotyp: | IgG1 |
| NCBI: | 2173 |
| UniProt: | O15540 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FABP7 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human cerebellum shows positivity in the molecular cell layer and Purkinje cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows immunoreactivity in a subset of glial cells. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line U-251 MG |
|
|
AMAb90595-100ul |
|
|
|
|
|
AMAb90595-100ul |
|
|
AMAb90595-100ul |
Produktgarantie und fachkundiger Support
