Anti-HER2 Antibody , IgG1, Clone: [CL0268], Unconjugated, Mouse, Monoclonal

Artikelnummer: ATA-AMAB90627
Artikelname: Anti-HER2 Antibody , IgG1, Clone: [CL0268], Unconjugated, Mouse, Monoclonal
Artikelnummer: ATA-AMAB90627
Hersteller Artikelnummer: AMAb90627
Alternativnummer: ATA-AMAB90627-100,ATA-AMAB90627-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ERBB2, CD340, HER-2, NEU, NGL
v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Anti-HER2
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL0268]
Isotyp: IgG1
NCBI: 2064
UniProt: P04626
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: YNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFGAPHR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HER2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 1 µg/ml
Immunohistochemical staining of human HER2-positive breast cancer shows strong membranous positivity in tumor cells.
Immunohistochemical staining of human HER2-negative breast cancer shows no positivity in tumor cells, as expected.
Western blot analysis in human cell line SK-BR-3 and human cell line MCF-7.
AMAb90627
AMAb90627
AMAb90627