Anti-HER2 Antibody , IgG1, Clone: [CL0268], Unconjugated, Mouse, Monoclonal
Artikelnummer:
ATA-AMAB90627
| Artikelname: |
Anti-HER2 Antibody , IgG1, Clone: [CL0268], Unconjugated, Mouse, Monoclonal |
| Artikelnummer: |
ATA-AMAB90627 |
| Hersteller Artikelnummer: |
AMAb90627 |
| Alternativnummer: |
ATA-AMAB90627-100,ATA-AMAB90627-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Mouse |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ERBB2, CD340, HER-2, NEU, NGL |
| v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) |
| Klonalität: |
Monoclonal |
| Konzentration: |
1 |
| Klon-Bezeichnung: |
[CL0268] |
| Isotyp: |
IgG1 |
| NCBI: |
2064 |
| UniProt: |
P04626 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Protein A purified |
| Sequenz: |
YNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFGAPHR |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
HER2 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:50 - 1:200, WB: 1 µg/ml |
|
Immunohistochemical staining of human HER2-positive breast cancer shows strong membranous positivity in tumor cells. |
|
Immunohistochemical staining of human HER2-negative breast cancer shows no positivity in tumor cells, as expected. |
|
Western blot analysis in human cell line SK-BR-3 and human cell line MCF-7. |
|
AMAb90627 |
|
|
|
AMAb90627 |
|
AMAb90627 |