Anti-SCGN
Artikelnummer:
ATA-AMAB90632
- Bilder (7)
| Artikelname: | Anti-SCGN |
| Artikelnummer: | ATA-AMAB90632 |
| Hersteller Artikelnummer: | AMAb90632 |
| Alternativnummer: | ATA-AMAB90632-100,ATA-AMAB90632-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CALBL, DJ501N12.8, SECRET, SEGN |
| secretagogin, EF-hand calcium binding protein |
| Anti-SCGN |
| Klonalität: | Monoclonal |
| Konzentration: | 0.1 |
| Klon-Bezeichnung: | [CL0273] |
| Isotyp: | IgG2a |
| NCBI: | 10590 |
| UniProt: | O76038 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SCGN |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemical staining of human cerebellum shows strong immunoreactivity in the molecular layer neurons. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic and nuclear positivity in the pancreatic islets cells. |
|
|
Immunohistochemical staining of human rectum shows strong immunoreactivity in neuroendocrine cells. |
|
|
Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control). |
|
|
AMAb90632-100ul |
|
|
AMAb90632-100ul |
|
|
AMAb90632-100ul |
Produktgarantie und fachkundiger Support
