Anti-FLT1
Artikelnummer:
ATA-AMAB90703
- Bilder (8)
| Artikelname: | Anti-FLT1 |
| Artikelnummer: | ATA-AMAB90703 |
| Hersteller Artikelnummer: | AMAb90703 |
| Alternativnummer: | ATA-AMAB90703-100,ATA-AMAB90703-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLT, VEGFR1 |
| fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) |
| Anti-FLT1 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL0344] |
| Isotyp: | IgG1 |
| NCBI: | 2321 |
| UniProt: | P17948 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | LNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FLT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human placenta and tonsil tissues using AMAb90703 antibody. Corresponding FLT1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in endothelial cells. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in endothelial cells, as well as positivity in smooth muscle. |
|
|
Immunohistochemical staining of human tonsil shows no cytoplasmic positivity in lymphoid cells as expected. |
|
|
AMAb90703-100ul |
|
|
AMAb90703-100ul |
|
|
AMAb90703-100ul |
Produktgarantie und fachkundiger Support
