Anti-PLA2R1
Artikelnummer:
ATA-AMAB90775
- Bilder (7)
| Artikelname: | Anti-PLA2R1 |
| Artikelnummer: | ATA-AMAB90775 |
| Hersteller Artikelnummer: | AMAb90775 |
| Alternativnummer: | ATA-AMAB90775-100,ATA-AMAB90775-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CLEC13C, PLA2-R, PLA2G1R, PLA2IR |
| phospholipase A2 receptor 1, 180kDa |
| Anti-PLA2R1 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL0485] |
| Isotyp: | IgG1 |
| NCBI: | 22925 |
| UniProt: | Q13018 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PLA2R1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human kidney with membranous nephropathy shows strong membranous immunoreactivity in renal glomeruli. |
|
|
Immunohistochemical staining of normal human kidney shows absence of positivity (negative control). |
|
|
Lane 1: Marker [kDa] Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: PLA2R1 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY423477) |
|
|
AMAb90775-100ul |
|
|
|
|
|
AMAb90775-100ul |
|
|
AMAb90775-100ul |
Produktgarantie und fachkundiger Support
