Anti-MMP9
Artikelnummer:
ATA-AMAB90806
- Bilder (8)
| Artikelname: | Anti-MMP9 |
| Artikelnummer: | ATA-AMAB90806 |
| Hersteller Artikelnummer: | AMAb90806 |
| Alternativnummer: | ATA-AMAB90806-100,ATA-AMAB90806-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CLG4B |
| matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) |
| Anti-MMP9 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL0542] |
| Isotyp: | IgG2b |
| NCBI: | 4318 |
| UniProt: | P14780 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MMP9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human lung shows strong immunoreactivity in the macrophages and granulocytes. |
|
|
Immunohistochemical staining of human spleen shows strong positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human placenta shows strong immunoreactivity in granulocytes. |
|
|
Immunohistochemical staining of human duodenum shows moderate to strong positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human uterus shows absence of immunoreactivity (negative control). |
|
|
AMAb90806-100ul |
|
|
AMAb90806-100ul |
|
|
AMAb90806-100ul |
Produktgarantie und fachkundiger Support
