Anti-THY1
Artikelnummer:
ATA-AMAB90844
- Bilder (8)
| Artikelname: | Anti-THY1 |
| Artikelnummer: | ATA-AMAB90844 |
| Hersteller Artikelnummer: | AMAb90844 |
| Alternativnummer: | ATA-AMAB90844-100,ATA-AMAB90844-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD90 |
| Thy-1 cell surface antigen |
| Anti-THY1 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL1028] |
| Isotyp: | IgG2b |
| NCBI: | 7070 |
| UniProt: | P04216 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | THY1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in neuropil. |
|
|
Immunohistochemical staining of human cerebellum shows positivity in the molecular layer. |
|
|
Immunohistochemical staining of human testis shows absence of immunoreactivity (negative control). |
|
|
Lane 1: Marker [kDa] Lane 2: Human cerebral cortex |
|
|
AMAb90844 |
|
|
AMAb90844-100ul |
|
|
AMAb90844 |
|
|
AMAb90844 |
Produktgarantie und fachkundiger Support
