Anti-RHOT1 Antibody , IgG1, Clone: [CL1083], Unconjugated, Mouse, Monoclonal

Artikelnummer: ATA-AMAB90852
Artikelname: Anti-RHOT1 Antibody , IgG1, Clone: [CL1083], Unconjugated, Mouse, Monoclonal
Artikelnummer: ATA-AMAB90852
Hersteller Artikelnummer: AMAb90852
Alternativnummer: ATA-AMAB90852-100,ATA-AMAB90852-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ARHT1, FLJ11040, MIRO-1
ras homolog family member T1
Anti-RHOT1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL1083]
Isotyp: IgG1
NCBI: 55288
UniProt: Q8IXI2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RHOT1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells, as well as positivity in neuropil.
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in striated muscle fibers.
Western blot analysis in human cerebral cortex tissue.
AMAb90852
AMAb90852
AMAb90852