Anti-RHOT1
Artikelnummer:
ATA-AMAB90854
- Bilder (7)
| Artikelname: | Anti-RHOT1 |
| Artikelnummer: | ATA-AMAB90854 |
| Hersteller Artikelnummer: | AMAb90854 |
| Alternativnummer: | ATA-AMAB90854-100,ATA-AMAB90854-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ARHT1, FLJ11040, MIRO-1 |
| ras homolog family member T1 |
| Anti-RHOT1 |
| Klonalität: | Monoclonal |
| Konzentration: | 0.7 |
| Klon-Bezeichnung: | [CL1095] |
| Isotyp: | IgG1 |
| NCBI: | 55288 |
| UniProt: | Q8IXI2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RHOT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells, as well as positivity in neuropil. |
|
|
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human skeletal muscle shows only very weak cytoplasmic positivity in striated muscle fibers. |
|
|
AMAb90854-100ul |
|
|
AMAb90854-100ul |
|
|
AMAb90854-100ul |
Produktgarantie und fachkundiger Support
