Anti-CD68
Artikelnummer:
ATA-AMAB90873
- Bilder (7)
| Artikelname: | Anti-CD68 |
| Artikelnummer: | ATA-AMAB90873 |
| Hersteller Artikelnummer: | AMAb90873 |
| Alternativnummer: | ATA-AMAB90873-100,ATA-AMAB90873-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp686M18236, GP110, LAMP4, macrosialin, SCARD1 |
| CD68 molecule |
| Anti-CD68 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL1338] |
| Isotyp: | IgG1 |
| NCBI: | 968 |
| UniProt: | P34810 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CD68 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human liver shows strong immunoreactivity in Kupffer cells. |
|
|
Immunohistochemical staining of human colon shows strong positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human tonsil shows strong immunoreactivity in single cells. |
|
|
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control). |
|
|
AMAb90873-100ul |
|
|
AMAb90873-100ul |
|
|
AMAb90873-100ul |
Produktgarantie und fachkundiger Support
