Anti-CD8A
Artikelnummer:
ATA-AMAB90883
- Bilder (8)
| Artikelname: | Anti-CD8A |
| Artikelnummer: | ATA-AMAB90883 |
| Hersteller Artikelnummer: | AMAb90883 |
| Alternativnummer: | ATA-AMAB90883-100,ATA-AMAB90883-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD8 |
| CD8a molecule |
Anti-CD8A
|
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL1529] |
| Isotyp: | IgG1 |
| NCBI: | 925 |
| UniProt: | P01732 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CD8A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human tonsil shows strong immunoreactivity in a subset of lymphoid cells outside the reaction centra. |
|
|
Immunohistochemical staining of human rectum shows strong positivity in a subset of lymphoid cells in lamina propria. |
|
|
Immunohistochemical staining of human small intestine shows strong immunoreactivity in a subset of lymphoid cells in lamina propria. |
|
|
Immunohistochemical staining of human fallopian tube shows strong positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control). |
|
|
AMAb90883-100ul |
|
|
AMAb90883-100ul |
|
|
AMAb90883-100ul |
Produktgarantie und fachkundiger Support
