Anti-MYH6
Artikelnummer:
ATA-AMAB90947
- Bilder (9)
| Artikelname: | Anti-MYH6 |
| Artikelnummer: | ATA-AMAB90947 |
| Hersteller Artikelnummer: | AMAb90947 |
| Alternativnummer: | ATA-AMAB90947-100,ATA-AMAB90947-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MYH6 |
| myosin, heavy chain 6, cardiac muscle, alpha |
| Anti-MYH6 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL2148] |
| Isotyp: | IgG1 |
| NCBI: | 4624 |
| UniProt: | P13533 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MYH6 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:5000 - 1:10000, WB: 1 µg/ml |
|
|
Immunohistochemistry analysis in human heart muscle and liver tissues using AMAb90947 antibody. Corresponding MYH6 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle shows very strong cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in striated muscle fibers. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Lane 1: Marker [kDa] Lane 2: Human skeletal muscle tissue lysate |
|
|
AMAb90947 |
|
|
|
|
|
AMAb90947 |
|
|
AMAb90947 |
Produktgarantie und fachkundiger Support
