Anti-PARP1

Artikelnummer: ATA-AMAB90959
Artikelname: Anti-PARP1
Artikelnummer: ATA-AMAB90959
Hersteller Artikelnummer: AMAb90959
Alternativnummer: ATA-AMAB90959-100,ATA-AMAB90959-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ADPRT, PARP, PPOL
poly (ADP-ribose) polymerase 1
Anti-PARP1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL2220]
Isotyp: IgG1
NCBI: 142
UniProt: P09874
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PARP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:1000 - 1:2500, WB: 1 µg/ml
Immunofluorescence staining in HeLa cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Immunofluorescence staining in A431 cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Immunofluorescence staining in MCF7 cell line with Anti-PARP1 monoclonal antibody, showing clear cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Immunofluorescence staining in U2OS cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Immunofluorescence staining in U251 cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).
Immunohistochemical staining of human fallopian tube shows strong nuclear immunoreactivity.
Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular and connective tissue cells.
Immunohistochemical staining of human small intestine shows strong nuclear immunoreactivity in the epithelial and lamina propria cells.
Immunohistochemical staining of human cervix shows strong nuclear positivity in epithelial cells.
Immunohistochemical staining of human rectum shows strong nuclear immunoreactivity in the epithelial and lamina propria cells.
Immunohistochemical staining of human liver shows strong nuclear positivity in hepatocytes.
Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PARP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Lane 1: Marker [kDa]
Lane 2: Human cell line RT-4
Lane 1: Marker [kDa]
Lane 2: Human cell line HeLa cytoplasmic fraction
Lane 3: Human cell line HeLa membrane fraction
Lane 4: Human cell line HeLa nuclear fraction
Lane 5: Human cell line HeLa chromatin fraction
Lane 6: Human cell line HeLa cytoskeletal fraction
AMAb90959-100ul
AMAb90959-100ul
AMAb90959-100ul