Anti-NEFH
Artikelnummer:
ATA-AMAB91025
- Bilder (8)
| Artikelname: | Anti-NEFH |
| Artikelnummer: | ATA-AMAB91025 |
| Hersteller Artikelnummer: | AMAb91025 |
| Alternativnummer: | ATA-AMAB91025-100,ATA-AMAB91025-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NEFH |
| neurofilament, heavy polypeptide |
| Anti-NEFH |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL2671] |
| Isotyp: | IgG1 |
| NCBI: | 4744 |
| UniProt: | P12036 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | ECRIGFGPIPFSLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NEFH |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human cerebellum shows moderate immunoreactivity in Purkinje cells and neural fibers. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neural fibers. |
|
|
Immunohistochemical staining of human tonsil shows absence of immunoreactivity (negative control). |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Cerebral Cortex tissue |
|
|
AMAb91025-100ul |
|
|
|
|
|
AMAb91025-100ul |
|
|
AMAb91025-100ul |
Produktgarantie und fachkundiger Support
