Anti-FCGRT
Artikelnummer:
ATA-AMAB91199
- Bilder (7)
| Artikelname: | Anti-FCGRT |
| Artikelnummer: | ATA-AMAB91199 |
| Hersteller Artikelnummer: | AMAb91199 |
| Alternativnummer: | ATA-AMAB91199-100,ATA-AMAB91199-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | alpha-chain, FCRN |
| Fc fragment of IgG, receptor, transporter, alpha |
| Anti-FCGRT |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL3638] |
| Isotyp: | IgG2a |
| NCBI: | 2217 |
| UniProt: | P55899 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FCGRT |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human liver shows strong immunoreactivity in Kupffer cells. |
|
|
Immunohistochemical staining of human lymph node shows strong positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human placenta shows immunoreactivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows absence of immunoreactivity (negative control). |
|
|
AMAb91199-100ul |
|
|
AMAb91199-100ul |
|
|
AMAb91199-100ul |
Produktgarantie und fachkundiger Support
