Anti-FOXJ1

Artikelnummer: ATA-AMAB91255
Artikelname: Anti-FOXJ1
Artikelnummer: ATA-AMAB91255
Hersteller Artikelnummer: AMAb91255
Alternativnummer: ATA-AMAB91255-100,ATA-AMAB91255-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FKHL13, HFH-4, HFH4
forkhead box J1
Anti-FOXJ1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL3991]
Isotyp: IgG1
NCBI: 2302
UniProt: Q92949
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FOXJ1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemical staining of human endometrium shows strong nuclear immunoreactivity in some glandular cells.
Immunohistochemical staining of human skeletal muscle shows no positivity as expected (negative control).
AMAb91255-100ul
AMAb91255-100ul
AMAb91255-100ul