Anti-CDKL5
Artikelnummer:
ATA-AMAB91323
- Bilder (8)
| Artikelname: | Anti-CDKL5 |
| Artikelnummer: | ATA-AMAB91323 |
| Hersteller Artikelnummer: | AMAb91323 |
| Alternativnummer: | ATA-AMAB91323-100,ATA-AMAB91323-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CFAP247, EIEE2, STK9 |
| cyclin-dependent kinase-like 5 |
| Anti-CDKL5 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL4888] |
| Isotyp: | IgG1 |
| NCBI: | 6792 |
| UniProt: | O76039 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | AARANSLQLLSPQPGEQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CDKL5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of cerebral cortex shows strong cytoplasmic immunoreactivity in neurons. |
|
|
Immunohistochemical staining of human testis shows weak nuclear positivity in a subset of cells in seminiferous tubules. |
|
|
Immunohistochemical staining of skeletal muscle shows absence of positivity in muscle fibres as expected (negative control). |
|
|
Western blot analysis in human cell line A-549. |
|
|
AMAb91323-100ul |
|
|
|
|
|
AMAb91323-100ul |
|
|
AMAb91323-100ul |
Produktgarantie und fachkundiger Support
