Anti-TYRP1
Artikelnummer:
ATA-AMAB91327
- Bilder (7)
| Artikelname: | Anti-TYRP1 |
| Artikelnummer: | ATA-AMAB91327 |
| Hersteller Artikelnummer: | AMAb91327 |
| Alternativnummer: | ATA-AMAB91327-100,ATA-AMAB91327-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAS2, TYRP, TYRRP, TRP |
| tyrosinase-related protein 1 |
| Anti-TYRP1 |
| Klonalität: | Monoclonal |
| Konzentration: | 0.7 |
| Klon-Bezeichnung: | [CL4917] |
| Isotyp: | IgG1 |
| NCBI: | 7306 |
| UniProt: | P17643 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TYRP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, IHC: 1:1000 - 1:2500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human skin shows strong cytoplasmic immunoreactivity in melanocytes. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in muscle fibers as expected (negative control). |
|
|
Western blot analysis in human cell line SK-MEL-30. |
|
|
AMAb91327-100ul |
|
|
AMAb91327-100ul |
|
|
|
|
|
AMAb91327-100ul |
Produktgarantie und fachkundiger Support
