Anti-CPA1
Artikelnummer:
ATA-AMAB91434
- Bilder (8)
| Artikelname: | Anti-CPA1 |
| Artikelnummer: | ATA-AMAB91434 |
| Hersteller Artikelnummer: | AMAb91434 |
| Alternativnummer: | ATA-AMAB91434-100,ATA-AMAB91434-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CPA |
| carboxypeptidase A1 |
| Anti-CPA1 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL6629] |
| Isotyp: | IgG1 |
| NCBI: | 1357 |
| UniProt: | P15085 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYET |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CPA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:5000 - 1:10000, WB: 1 µg/ml |
|
|
Immunohistochemistry analysis in human pancreas and tonsil tissues using AMAb91434 antibody. Corresponding CPA1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
Western blot analysis in human pancreas tissue. |
|
|
AMAb91434-100ul |
|
|
|
|
|
AMAb91434-100ul |
|
|
AMAb91434-100ul |
Produktgarantie und fachkundiger Support
