Anti-CD47
Artikelnummer:
ATA-AMAB91440
- Bilder (8)
| Artikelname: | Anti-CD47 |
| Artikelnummer: | ATA-AMAB91440 |
| Hersteller Artikelnummer: | AMAb91440 |
| Alternativnummer: | ATA-AMAB91440-100,ATA-AMAB91440-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IAP, MER6, OA3 |
| CD47 molecule |
| Anti-CD47 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL6913] |
| Isotyp: | IgG1 |
| NCBI: | 961 |
| UniProt: | Q08722 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CD47 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using AMAb91440 antibody. Corresponding CD47 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil. |
|
|
Immunohistochemical staining of human lung shows moderate membranous positivity in pneumocytes. |
|
|
Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
AMAb91440-100ul |
|
|
AMAb91440-100ul |
|
|
AMAb91440-100ul |
Produktgarantie und fachkundiger Support
