Anti-ITGA6
Artikelnummer:
ATA-AMAB91450
- Bilder (8)
| Artikelname: | Anti-ITGA6 |
| Artikelnummer: | ATA-AMAB91450 |
| Hersteller Artikelnummer: | AMAb91450 |
| Alternativnummer: | ATA-AMAB91450-100,ATA-AMAB91450-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD49f |
| integrin subunit alpha 6 |
| Anti-ITGA6 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL6957] |
| Isotyp: | IgG1 |
| NCBI: | 3655 |
| UniProt: | P23229 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ITGA6 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |








