Anti-XPNPEP2
Artikelnummer:
ATA-HPA000339
- Bilder (6)
| Artikelname: | Anti-XPNPEP2 |
| Artikelnummer: | ATA-HPA000339 |
| Hersteller Artikelnummer: | HPA000339 |
| Alternativnummer: | ATA-HPA000339-100,ATA-HPA000339-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | XPNPEP2 |
| X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound |
| Anti-XPNPEP2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7512 |
| UniProt: | O43895 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | XPNPEP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human small intestine and liver tissues using Anti-XPNPEP2 antibody. Corresponding XPNPEP2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA000339-100ul |
|
|
HPA000339-100ul |
|
|
HPA000339-100ul |
Produktgarantie und fachkundiger Support
