Anti-HSPB1
Artikelnummer:
ATA-HPA000497
- Bilder (8)
| Artikelname: | Anti-HSPB1 |
| Artikelnummer: | ATA-HPA000497 |
| Hersteller Artikelnummer: | HPA000497 |
| Alternativnummer: | ATA-HPA000497-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Hs.76067, Hsp25, HSP27, HSP28 |
| heat shock 27kDa protein 1 |
| Anti-HSPB1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3315 |
| UniProt: | P04792 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HSPB1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human skin and pancreas tissues using Anti-HSPB1 antibody. Corresponding HSPB1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Western blot analysis in human cell lines MCF-7 and Caco-2 using Anti-HSPB1 antibody. Corresponding HSPB1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
HPA000497-100ul |
|
|
|
|
|
HPA000497-100ul |
|
|
HPA000497-100ul |
Produktgarantie und fachkundiger Support
