Anti-DNAJB7

Artikelnummer: ATA-HPA000534
Artikelname: Anti-DNAJB7
Artikelnummer: ATA-HPA000534
Hersteller Artikelnummer: HPA000534
Alternativnummer: ATA-HPA000534-100,ATA-HPA000534-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HSC3
DnaJ (Hsp40) homolog, subfamily B, member 7
Anti-DNAJB7
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 150353
UniProt: Q7Z6W7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDKYGTEGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRNRDAGYFFSTASEYP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJB7
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human testis shows strong cytoplasmic and positivity in cells of seminiferous ducts.
HPA000534-100ul