Anti-NAGA
Artikelnummer:
ATA-HPA000649
- Bilder (8)
| Artikelname: | Anti-NAGA |
| Artikelnummer: | ATA-HPA000649 |
| Hersteller Artikelnummer: | HPA000649 |
| Alternativnummer: | ATA-HPA000649-100,ATA-HPA000649-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | D22S674 |
| N-acetylgalactosaminidase, alpha- |
| Anti-NAGA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4668 |
| UniProt: | P17050 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | WLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFST |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NAGA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human parathyroid gland and cerebral cortex tissues using Anti-NAGA antibody. Corresponding NAGA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human parathyroid gland shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue |
|
|
HPA000649-100ul |
|
|
|
|
|
HPA000649-100ul |
|
|
HPA000649-100ul |
Produktgarantie und fachkundiger Support
