Anti-FCN1
Artikelnummer:
ATA-HPA000685
- Bilder (6)
| Artikelname: | Anti-FCN1 |
| Artikelnummer: | ATA-HPA000685 |
| Hersteller Artikelnummer: | HPA000685 |
| Alternativnummer: | ATA-HPA000685-100,ATA-HPA000685-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FCNM |
| ficolin (collagen/fibrinogen domain containing) 1 |
| Anti-FCN1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2219 |
| UniProt: | O00602 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FCN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells. |
|
|
Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue |
|
|
HPA000685-100ul |
|
|
|
|
|
HPA000685-100ul |
|
|
HPA000685-100ul |
Produktgarantie und fachkundiger Support
