Anti-BID

Artikelnummer: ATA-HPA000722
Artikelname: Anti-BID
Artikelnummer: ATA-HPA000722
Hersteller Artikelnummer: HPA000722
Alternativnummer: ATA-HPA000722-100,ATA-HPA000722-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
BH3 interacting domain death agonist
Anti-BID
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 637
UniProt: P55957
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLAR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BID
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry analysis in human bone marrow and testis tissues using Anti-BID antibody. Corresponding BID RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bone marrow shows high expression.
Immunohistochemical staining of human testis shows low expression as expected.
Western blot analysis in human cell lines MCF-7 and HeLa using Anti-BID antibody. Corresponding BID RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line EFO-21
Lane 4: Human cell line A-431
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA000722-100ul
HPA000722-100ul
HPA000722-100ul