Anti-INF2
Artikelnummer:
ATA-HPA000724
- Bilder (7)
| Artikelname: | Anti-INF2 |
| Artikelnummer: | ATA-HPA000724 |
| Hersteller Artikelnummer: | HPA000724 |
| Alternativnummer: | ATA-HPA000724-100,ATA-HPA000724-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C14orf151, C14orf173, MGC13251 |
| inverted formin, FH2 and WH2 domain containing |
| Anti-INF2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 64423 |
| UniProt: | Q27J81 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | INF2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in podocytes and cells in tubules. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in striated muscle fibers. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
HPA000724-100ul |
|
|
HPA000724-100ul |
|
|
HPA000724-100ul |
Produktgarantie und fachkundiger Support
