Anti-TOM1

Artikelnummer: ATA-HPA000818
Artikelname: Anti-TOM1
Artikelnummer: ATA-HPA000818
Hersteller Artikelnummer: HPA000818
Alternativnummer: ATA-HPA000818-100,ATA-HPA000818-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: TOM1
target of myb1 membrane trafficking protein
Anti-TOM1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 10043
UniProt: O60784
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TOM1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Western blot analysis in human cell line U-87 MG.
Western blot analysis in human cell line RT-4, human cell line EFO-21, human cell line A-431, human liver tissue and human tonsil tissue.
HPA000818-100ul
HPA000818-100ul
HPA000818-100ul